PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca31737.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 330aa    MW: 37598.7 Da    PI: 5.2566
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca31737.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.72.2e-53151431128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..kg 97 
                 + pGfrFhPtdeelv +yLk+k+++++l++ e ik++diyk++PwdLpk ++++ekewyfF++rd+ky++++r+nr+t +g+Wkatg+d++++s+  ++
  Dca31737.1  15 MLPGFRFHPTDEELVGFYLKRKIQQRPLSI-ELIKQLDIYKFDPWDLPKIASGGEKEWYFFCPRDRKYRNSTRPNRVTGAGFWKATGTDRPIYSSegRN 112
                 579***************************.89***************88888999**************************************96666 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 + +glkk+Lvfykgra kg+ktdW+mhe+rl
  Dca31737.1 113 KCIGLKKSLVFYKGRAAKGVKTDWMMHEFRL 143
                 67***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.45E-5611145IPR003441NAC domain
PROSITE profilePS5100552.02315168IPR003441NAC domain
PfamPF023651.1E-2617143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0045770Biological Processpositive regulation of asymmetric cell division
GO:0048103Biological Processsomatic stem cell division
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MESKNEGEQK ADEVMLPGFR FHPTDEELVG FYLKRKIQQR PLSIELIKQL DIYKFDPWDL  60
PKIASGGEKE WYFFCPRDRK YRNSTRPNRV TGAGFWKATG TDRPIYSSEG RNKCIGLKKS  120
LVFYKGRAAK GVKTDWMMHE FRLPSLCDSI PSKKCIDPTI IPANVRFSYP TNGNNVENKP  180
CFDQQFLNIP PMLDLPSSYI LPQLLEEPYE VSKSSIDISS MLSNNMSSMQ GCFSEPSEDG  240
HINFEGLLPS IINNGQFQDD IQHNVHNVVG DVNDYDFRVN LEDFQEFQST LMCNLSNLSG  300
ATQTGLLPLV LPETWKTPLA SLVWDCTPLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-5211431140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015895075.11e-100PREDICTED: protein FEZ
TrEMBLA0A068TVM01e-97A0A068TVM0_COFCA; Uncharacterized protein
STRINGGLYMA01G05680.17e-95(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.12e-87NAC family protein